TB-500

TB-500 is the common research-market name for synthetic thymosin beta-4, a forty-three amino acid peptide that occurs naturally in nearly every mammalian cell type and is among the most abundant intracellular proteins in many tissues. Its established biochemical function is not signaling at all. It is the principal sequestering protein for monomeric G-actin, holding a reserve pool of unpolymerized actin subunits that the cell can deploy when it needs to rebuild its cytoskeleton quickly.

That primary function is settled biochemistry and has been for decades. The research interest that surrounds TB-500 concerns a second set of reported activities, sometimes described in the literature as moonlighting functions, in which extracellular thymosin beta-4 or fragments of it have been associated with cell migration, vascular formation, inflammatory signaling, and fibrotic remodeling in injury models. Those reported activities, unlike the actin biochemistry, are still being characterized.

A naming caveat matters here. Material sold under the TB-500 label is not always the same molecule. Some vendors supply full-length thymosin beta-4, others supply the shorter fragment containing the central actin-binding region, and the two are not interchangeable for experimental purposes. The specifications on this page correspond to full-length thymosin beta-4 at approximately 4963 g/mol. Researchers should confirm the identity of any lot against its mass spectrometry data rather than against the product name.

Thymosin beta-4 was first isolated from bovine thymus tissue in the 1960s and 1970s as part of the broader effort to characterize thymic factors thought to direct immune cell maturation. The name is a historical artifact of that program. Subsequent work showed the peptide is present in essentially all tissues rather than being thymus-specific, and that its abundance is unrelated to any thymic hormonal role.

The decisive reframing came in 1991, when independent groups identified thymosin beta-4 as the major G-actin sequestering molecule in the cytoplasm. That result moved the peptide out of immunology and into cytoskeletal cell biology, where its function is now unambiguous. Later work through the 1990s and 2000s at the National Institutes of Health and elsewhere reported extracellular activities in corneal and dermal wound models in rodents and rabbits, and a widely cited 2004 report described effects on cardiac cell migration and survival in a mouse model of cardiac injury.

The peptide has also been carried into formal clinical development, which distinguishes it from most compounds in this category. Topical ophthalmic formulations of synthetic thymosin beta-4 have been evaluated in registered, randomized human trials for ocular surface conditions, including a published phase 2 dry eye trial. Those trials involve a topical eye drop, not the injectable research peptide, and their results do not transfer to any other route or indication. Separately, TB-500 appears on the World Anti-Doping Agency Prohibited List under the peptide hormones and growth factors category, and researchers working in athletic contexts should treat it accordingly.

Full-length thymosin beta-4 is a linear forty-three residue peptide, molecular formula C212H350N56O78S, average molecular weight approximately 4963 g/mol, CAS number 77591-33-4. Its sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. In its native form the amino terminus is acetylated. The molecule contains a single methionine and no cysteine, so there is no disulfide bond, and it is strongly acidic overall because of its high aspartate and glutamate content.

Structurally, thymosin beta-4 is an intrinsically disordered protein. In free solution it has no stable fold, adopting defined helical segments only upon binding actin. This is functionally important, because a disordered chain can wrap along the length of an actin monomer in a way a rigid globular protein cannot. It also has a practical consequence for handling: there is no tertiary structure to denature, so the usual concerns about refolding after lyophilization do not apply.

The central heptapeptide motif LKKTETQ, spanning residues seventeen through twenty-three, is the region most often described as the actin-binding domain, and several published studies use that short fragment or extended versions of it in place of the full protein. Reported activities of the fragment and of the full-length peptide overlap but are not identical, which is a recurring source of confusion when comparing published results to material purchased under the TB-500 name. The primary degradation route in solution is backbone hydrolysis, with oxidation of the single methionine residue as a secondary concern under oxidizing conditions or prolonged air exposure.

The established mechanism is actin sequestration. Thymosin beta-4 binds monomeric G-actin in a one-to-one complex and prevents its addition to filament ends, maintaining a large kinetically available pool of unpolymerized actin. When a cell needs to extend a lamellipodium or reorganize its cortex, that reserve is released to profilin and then to growing filaments. This buffering role is the reason the peptide is so abundant, and it is not in dispute.

The proposed extracellular mechanisms are less settled. Reported associations include increased endothelial cell migration and vessel formation in angiogenesis assays, upregulation of laminin-5 in corneal epithelium, and downregulation of nuclear factor kappa B signaling with reduced inflammatory cytokine and chemokine output in injury models. An anti-fibrotic hypothesis has also been described, in which exposure is associated with reduced myofibroblast transition and altered collagen deposition patterns rather than simply more collagen.

Intracellular partners beyond actin have been reported as well, including an interaction with the DNA repair-associated protein Ku80 and effects on integrin-linked kinase signaling described in the cardiac work. Whether these represent distinct pathways or downstream consequences of altered cytoskeletal dynamics has not been resolved. Cytoskeletal state feeds into a wide range of signaling systems, so a compound that changes actin availability can produce transcriptional effects without acting on any receptor at all.

What is established: the identity, structure, abundance, and actin-sequestering function of thymosin beta-4 are well characterized and independently confirmed across many laboratories. Its intrinsic disorder and its binding mode with G-actin are described in structural detail. This part of the literature is ordinary, solid cell biology.

What has limited human data: topical ophthalmic thymosin beta-4 has been evaluated in registered randomized human trials, including a published phase 2 trial in severe dry eye. This is a meaningful distinction from most compounds in this library, which have no human trial exposure at all. However, those trials studied a topical eye drop in an ocular indication. They provide no basis for conclusions about systemic exposure, about any other tissue, or about the injectable research peptide.

What is preliminary or absent: the tissue repair literature that drives most interest in TB-500 is rodent and rabbit work, including tendon, dermal wound, corneal, and cardiac injury models. There is no completed human clinical trial of injectable thymosin beta-4 for any musculoskeletal or systemic application. Human pharmacokinetics for that route have not been published. Long-term safety in humans is unstudied. The pro-angiogenic and pro-migratory activities reported in models are the kind of activity that requires careful safety characterization before any human conclusion is reasonable, and that characterization has not been done.

The summary a researcher should carry forward is that TB-500 sits on a firm biochemical foundation with an unfinished translational story. The actin biology is real. The repair claims are hypotheses supported by animal models and one narrow line of topical human ophthalmic evidence that does not generalize.

The lyophilized peptide is stable when kept dry and cold. Long-term storage is at -20 C or below; 2 to 8 C is appropriate for short-term working inventory. Because the powder is hygroscopic, vials should reach room temperature before being opened so that condensation does not form on the cake, and they should be closed again promptly.

Thymosin beta-4 is highly water soluble and reconstitutes readily. Diluent should be added slowly down the vial wall rather than directly onto the powder, and the vial should be swirled gently or left to dissolve without agitation. Because the peptide is intrinsically disordered, there is no fold to recover, but shear and foaming at the air-liquid interface still promote aggregation and adsorptive loss, so vortexing is avoided.

Reconstituted stock is kept at 2 to 8 C and protected from light. Aliquoting into single-use volumes prevents the cumulative degradation caused by repeated freeze and thaw cycles, which is the most common unrecorded source of variability between experiments. Peptides of this length also adsorb measurably to glass and to some plastics at low concentrations, so researchers working in the low microgram per milliliter range should consider low-binding labware and should validate concentration rather than assume it. Label every aliquot with compound, lot, concentration, diluent, and reconstitution date.